• Megújítva
Rekombináns Veszettség vírus Glikoprotein G (G) (Rekombináns Fehérje)
zoom_in

Rekombináns Veszettség vírus Glikoprotein G (G) (Rekombináns Fehérje)

HUF 4617.00

Készleten
check Rendelhető

Gene Name : G. Syn Name : Rekombináns Glikoprotein G (G); Glikoprotein G ; Glikoprotein G. Forrás : E. Coli, vagy Élesztő.Tisztaság : >90%(SDS-PAGE); *Címke Információk : A jelölt.Faj : Veszettség vírus (törzs PM1503/AVO1) (RABV).Tároló Puffer : 20 mm Trisz-Hcl, 0,5 M Arg, PH 8.0,50% - os glicerin.SZABAD-8 GB-USBDrive ezt az elemet.Napirendi pont a kutatás használ.NEM a diagnosztikai/terápiás eljárás. *Forma : Ez az elem megköveteli az egyéni termelés átfutási idő között 5-9 hét.Mi lehet egyéni előállítani szerint az előírások.; *Seq : KFPIYTIPDELGPWSPIDIHHLSCPNNLVVEDEGCTNLSEFSYMELKVGYISAIKVNGFTCTGVVTEAETYTNFVGYVTTTFKRKHFRPTPDACRAAYNWKMAGDPRYEESLHNPYPDYHWLRTVRTKESLIIISPSVTDLDPYDKSLHSRGFPGGKCSGITVSSTYCSTNHDYTIWMPENPGPRTPCDIFTNSRGKRASKGNKTCGFVDERGLYKSLKGACRLKLCGVLGLRLMDGTWVAMQTSDETKWCPPDLVNLHDFRSDEIEHLVVEELVKKREECLDALESIMTTKSVSFRRLSHLRKLVPGFGKAYTIFNKTLMEADAHYKSVRTWNEIIPSKGCLKVGGRCHPHVNGVFFNGIILGPDGHVLIPEMQSSLLQQMELLKSSVIPLMHPLADPSTVFKEGDEAEDFVEVHLPDVYKQISGVDLGLPNWGKY; *Tárolás : Tárolja a -20?, hosszabb tárolása, megőrzése -20? vagy -80?.Megjegyzések ?Ismételt fagyás, illetve olvadás nem ajánlott.Bolt működik aliquot 4-kor? akár egy héten.; *Csatlakozási# : P15199.2; P15199; *Uniprot Összefoglaló : Funkció : Tulajdonít a vírus, hogy a fogadó sejt receptor, indukáló endocytosis a virion.A endosome, a savas p H-t indukálja conformational változások a glikoprotein trimer, amely ravaszt fusion között vírus-sejt membrán.Nincs meggyőző in vitro bizonyíték arra, hogy az izomzatot a kezdjék acetilkolin receptor (n ACh R), a neuronális sejt adhéziós molekula (NCAM), valamint a p75 neurotrophin receptor (p75 NTR) bind glikoprotein G s ezáltal megkönnyítse a veszettség vírus belépés sejtek Által hasonlóság.Alegység szerkezet : Homotrimer.Együttműködik mátrix fehérje Által hasonlóság.Lehetséges helyszín : Virion membrán; Egyetlen-pass típusú membrán fehérje Lehetséges.Poszt-transzlációs módosítás : Glikozilált, valamint palmitoylated által fogadó.Glikozilációs elengedhetetlen a glikoprotein export a sejt felszíni hasonlóság Által.Biotechnológiai használni : Elsődleges felszíni antigén képes indukálni, illetve reagál a vírus-semlegesítő antitestek.Szinte minden emberi, illetve állatgyógyászati vakcinák alapján a funkcionális szempontból a G fehérje.Egyéb : Arg-352 nagymértékben vett részt a veszettség vírus patogenitási.A mutáció drámaian csökkenti a vírus Által hasonlóság.Se.

Vevők, ahogy választanak..